• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×
  • 05 Apr 17
title

Bovis Homes rejects merger with Galliford Try, appoints new CEO

  • 1146 views
James Valentine

Digital editor at Research Tree

 
Bovis
Strap line

Galliford CEO Greg Fitzgerald will join the housebuilder as of 18 April

Companies: Galliford Try Holdings PLC, Vistry Group PLC


Body

 

FTSE 250 house builder Bovis Homes announced on Wednesday that it has appointed Galliford Chief-Exec Greg Fitzgerald as its new CEO and rejected a merger with the same firm.

 

In an update to investors, Bovis said Mr Fitzgerald would start on 18 April, with interim CEO Earl Sibley returning to his position as Group Finance Director. 

 

Mr Fitzgerald has spent the past 30 years building a career at Galliford, where he increased the scale of its housebuilding business and improved profitability. At Bovis, his annual salary will be £650k, and he will get an annual bonus of up to 100% of his salary payable in shares.


Non-Exec Chairman Ian Tyler said he was delighted that Mr Fitzgerald was joining as the new CEO:

 

"He brings a wealth of house building experience and I am confident he will rapidly drive performance across the Bovis business."

Mr Fitzgerald added that Bovis was a "great brand" with excellent people and a high-quality land bank. He said he was looking forward to joining the management team to "restore" Bovis' reputation as a leading housebuilder to deliver improved returns to investors. 

 

Rejection of Galliford proposal


Bovis said it had been in discussions with Galliford to evaluate the merits of a merger proposal, focusing on potential synergies that might result from a combination of the two businesses.

 

However, those discussions ultimately proved unsuccessful as the Bovis Board believed the merger undervalued the underlying Bovis business.

 

"Accordingly, the Board has decided to reject the proposal as it believes that an independent strategy under the leadership of Greg Fitzgerald will deliver greater value for shareholders." 

Operational Update

 

Buried in today's busy news flow, Bovis also released an operational update, saying that current sales and reservations were in line with the Board's expectations. 

 

The firm says it is making progress with its 2017 priorities, with operational processes and controls improved across all regions:


"We have significantly enhanced our customer service function across all regions and more than half of all Bovis employees have participated in a bespoke Customer Training Programme, with all employees targeted by the end of April. In addition, we are making good progress with resolving the high level of customer service issues we faced at the start of 2017."

The Group says it is trying to improve performance through cost efficiencies, more effective build processes and improvements in quality.

 

Shares in Bovis rose 2% on Wednesday to 865p, with Galliford shares up marginally at 1475p.

 

 

 


Body Two

Body Three

Body Four

Body Five

The information contained within this post is based on personal experience and opinion and should not be considered as a recommendation to trade nor financial advice.

More Content

More Content

Vox Markets Video Wrap

Companies: TUNACGSAASENSIONDOVTYCNCELCOTATEZTFITRKVLEPAYEOGGRISRTTPTGATCZOOCRWBVXPHVOKMKXPFTPFGNIOXPEBBSPIGAMAOTBRMRCRDLBKSTBTGGWMOCTAMPALATGLST

Vox Markets

Most popular equity research this week | 15 Jan - 19 Jan

Companies: BTRWBWYCARVTYPSNTW/TEFBKGINLCALLHURCRSTWJGAIRSPRAA/GLEMCSCSPABBYCRNKAPERDWWFRIR0ROYNEXN

Research Tree

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

Vox Markets

Most popular equity research this week | 14 - 25 Jan

Companies: MODARSVNPNDABBYISVJFIGRMTOKLRKIEMERSRPMGNSBABPAYSTAFSOLGVNETZOOCPICALLCOSTCAMLFNTLGFRDAA/HSVPMIBUR0RUYKETLBWJ2FXRG8

Research Tree

PANMURE LIBERUM: 4S: Same, same but different

Companies: SRP STAF FRAN PEBB GFRD YU/ SRC

Panmure Liberum
next
 
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Alternative Resource Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Primary Portal
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • RBC Capital Markets
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Investor Summit
      • The Life Sciences Division
      • ThinkFront
      • Ticker TV
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Venn Brown
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In