• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×
  • 11 Jan 21
title

Looking Ahead - w/c Jan 11th 2021

  • 2428 views
Research Tree

News and commentary covering all the latest events in the City

 
looking ahead research tree jan 2020
Strap line

Looking Ahead At The Next Week

Companies: ACRL, BOW, FIF, FOX, GAW, IKA, KMK, PFD


Body

Company news, such as Interim results, Final results, AGM statements and Trading Updates, are all recognised by active investors as being spurs that generate interest and dealing activity.

This column highlights some company news that will be announced in the week ahead.

Check out any of the companies mentioned by using the Research-Tree Companies Research link.


 

Monday 11th January

Interims:                     None declared

Finals:                        None declared

Trading Updates:     Abcam (ABC), Sig (SHI),

AGMs:                        Equatorial Palm Oil (PAL), Honye Financial Services (HOYE), Premier Foods (PFD) General Meeting

Research Tree Comment: 

Towards the end of June last year Edison Research were positive about the outlook for ambient foods sector group Premier Foods (PFD). That was subsequent to the annual results to end March. The first half saw a 15% revenue rise to £421.5m, upon which the company in the 26 weeks to end September reported a 50.2% adjusted pre-tax profits rise to £47.7m.

The group sold off its stake in Hovis for a net £37.3m early last November and has accelerated its overall debt reduction. This days General Meeting is to approve the Capital Reduction as part of the group’s recent strategic turnaround programme.



Tuesday 12th January

Interims:                     Accrol Grp Hldgs (ACRL), Games Workshop (GAW), Gateley Hldgs (GTLY),

Finals:                        None declared

Trading Updates:     DFS Furniture (DFS), JD Sports (JD.), Vistry Grp (VTY), THG Hldgs (THG), XP Power (XPP),

AGMs:                        Carrs Grrp (CARR), Impax Environmental Mkts (IEM), Myanmar Invs Int (MIL), Premier Oil (PMO), RDL Realisation (RDL),

Research Tree Comment: 

The interims from Accrol Group (ACRL), the loo roll and kitchen towel maker, should be positive. The recent acquisition of the Leicester Tissue Company was earnings enhancing, but those will show up in the H2 results. Liberum Capital analyst Wayne Brown is very bullish and reckons that the group is growing into a much larger, financially and operationally robust business.

Rating the LTC deal as ‘transformational’ brokers Zeus Capital considers that a share price of 69p-78p over the next year is a re-rated target. They are going for adjusted pre-tax profits of £8.5m (£4.7m) for the year to end April 2021, while predicting £17.5m for next year.

Edison Research considered that the first half trading update from Games Workshop (GAW) showed impressive momentum as the table-top miniature games maker goes into its second half year. This day’s interim results could well see revenue and profit estimates being uplifted.



Wednesday 13th January

Interims:                     Kromek Grp (KMK), Rosslyn Data Technologies (RDT),

Finals:                        None declared

Trading Updates:     Asos (ASC), Ferrexpo (FXPO), Persimmon (PSN), J. Sainsbury (SBRY), Topps Tiles (TPT),

AGMs:                        AB Dynamics (ABD), Majedie Invs (MAJE), Octagonal (OCT), Real Good Food (RGD), Tasty (TAST) General Meeting,

Research Tree Comment: 

The interim results to end October are due to be announced on this day the Kromek Group (KMK), the radiation detection company. In a recent, early December review on the company, Equity Developments stated that the shares appeared to be attractively priced as the group continues to win new contracts. It focusses its detection technology products upon the medical, security screening and nuclear markets.

On 1st January this year, when retiring from the group’s Board, Sir Peter Williams, non-executive Chairman, stated that he is looking forward to watching its continued progress. Current year revenue and profit forecasts are likely to be reinstated with this interim statement.

In mid-October brokers SP Angel updated comment upon the group’s new research and development project in cancer surgery.

While just a week earlier analyst Simon Strong at brokers Cenkos Securities declared the company to be getting back on track, with no diminution of market opportunity.

Just before Christmas the UK branded restaurant operator Tasty (TAST) announced that it was trading from 54 of its ‘Dim t’ and ‘Wildwood’ branches. But that was before the latest lockdown. However, it intended to offer takeaway and delivery services across 43 open units. It has achieved rent reductions and lease concessions on more than half of its estate, but trading continues to be challenging. This days General Meeting covers a related party transaction, issue of growth shares and adopting new articles.

On the group’s interims at the end of October, broker Cenkos Securities was impressed that the group had continued to benefit from its debt free balance sheet, while increasing its year-on-year net cash position.



Thursday 14th January

Interims:                     Gateley Holdings (GTLY), Ilika (IKA),

Finals:                        Blue Prism Grp (PRSM), Safestore Hldgs (SAFE), Titon Hldgs (TON),

Trading Updates:     Boohoo Grp (BOO), Brooks Macdonald Grp (BRK), Card Factory (CARD), Dunelm Grp (DNLM), Hays (HAS), Lamprell (LAM), Taylor Wimpey (TW.), Tesco (TSCO), Whitbread (WTB), Workspace Grp (WKP), Wood Grp (WG.)

AGMs:                        AA (AA.), Associated British Foods (ABF), C&C Grp (CCR), Cardiff Property (CDFF), Future (FUTR), Goco Grp (GOCO), ICG-Longbow (LBOW),

Research Tree Comment: 

The interim results to end October last, from Ilika (IKA), the pioneer in solid-state battery technology, will be eagerly anticipated by investors. Demand from the automotive sector will be impactive. The group is said to be confident about the prospects for its Goliath larger format batteries, but states that mass market commercialisation is dependent on further technical development and successful manufacturing scale-up.

Brokers to the company Liberum Capital noted that first half trading was in-line and considered that there have been a number of positive developments in relation to the market for large format batteries. After a recent surge the group’s shares are currently trading at 178p, a high for the last year.

Elsewhere the Christmas Trading Season reports continue this day Card Factory (CARD), Dunelm Group (DNLM), Tesco (TSCO) and Whitbread (WTB).

We will also see an update from the recently highly publicised Boohoo Group (BOO), which is seen by its brokers Zeus Capital as a clear market leader in the global e-commerce sector.



Friday 15th January

Interims:                     Finsbury Food Grp (FIF),

Finals:                        None declared

Trading Updates:     Frontier Developments (FDEV),

AGMs:                        Katoro Gold (KAT) General Meeting, Marwyn Value Investors (MVI), Summerway Capital (SWC), Zenith Energy (ZEN),                         

Research Tree Comment: 

Towards the end of last November brokers Cenkos Securities reinstated their revenue and profit forecast for Finsbury Food Group (FIF). This day will see the Pre-Close Interim Trading Update for the six months to end December from this leading UK speciality bakery manufacturer of cakes, breads and morning foods.

Resilient trading was described in the group’s AGM statement, convincing the broker to update its rating on the shares from being ‘Under Review’ to being a ‘Buy’.

On this day Katoro Gold (KAT) will be holding a General Meeting to seek shareholders approval for the increase of its capital following a much-needed Placing of £960,000 @ 2p a share.

That oversubscribed fund raising helps to boost the company’s working capital for its gold and nickel exploration and development activities.

Both SP Angel and Hybridan follow the company, which announced on 30th December that it had commenced drilling at its 65% owned Haneti Nickel Project in central Tanzania.


Body Two

Body Three

Body Four

Body Five

The information contained within this post is based on personal experience and opinion and should not be considered as a recommendation to trade nor financial advice.

More Content

More Content

Games Workshop Group:A good beat for FY26

Companies: Games Workshop Group PLC

Edison

Ilika’s Goliath batteries: the path toward safer, faster-charging EVs - Part 3

Companies: Ilika plc

Proactive

Ilika CEO: 'Multiples' of first-year revenue expected as solid-state battery momentum builds

Companies: Ilika plc

Proactive

2 P's on a Pod: Is M&A a Key Signal in Equity Markets Right Now?

Companies: SAASVTYTATEITRKVLEGRITPTGATCCRWHVOKMKXPFTPFGPEBBSPIGAMAOTBCRDLCTAATG

Vox Markets

Morning Note – 21 May 2026

Companies: IPX RBN MBH SDI IKA NXQ IXI HDD SEA HAYD

Cavendish
next
 
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Alternative Resource Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • Greenwood Capital Partners
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Primary Portal
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • RBC Capital Markets
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Investor Summit
      • The Life Sciences Division
      • ThinkFront
      • Ticker TV
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Venn Brown
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In