• Research Tree
  • Features
  • Pricing
  • Events
  • Reg.News
  • Short Interest
  • Explore Content
    • Explore

      • Providers
        • Providers

          • Free/Commissioned
          • High Net Worth Offering
          • Institutional Offering

          Free/Commissioned

          Research that is free to access for all investors. Companies commission these providers to write research about them.

          View Research

          What is our Main Bundle Offering?

          Brokers who write research on their corporate clients and make it available through our main bundle offering.

          View Research

          What is Institutional?

          Research that is paid for directly by asset managers. Only accessible to institutional investors permissioned for access.

          View Research
      • Regions
        • Regions

          • UK
          • Rest of EMEA
          • N America
          • APAC
          • LatAm
      • Exchanges
        • Exchanges

          • Aquis Apex
          • Australian Securities Exchange
          • Canadian Securities Exchange
          • Euronext Paris
          • London Stock Exchange (domestic)
          • SIX Swiss Exchange
      • Sectors
        • Sector Coverage

          • Building & Construction
          • Discretionary Personal Goods
          • Discretionary Retail
          • Energy
          • Health
          • Investment Trusts
          • Media
          • Resources
          • Technology
      • Small / Large Cap
        • Small / Large Cap

          • UK100
          • UK250
          • UK Smallcap
          • UK Other Main Markets
          • Other
  • Login
  • Sign Up
LIVE

Event in Progress:

Join Here ×

working
  • 05 Feb 2026

MIXI Inc. (2121) Q3 FY3/26 results update: Growth engine emerging


MIXI Inc. (2121:TKS), 0 | Gungho Online Entertainment, Inc. (3765:TKS), 0 | COLOPL, Inc. (3668:TKS), 0 | DeNA Co., Ltd. (2432:TKS), 0 | CyberAgent Incorporated (4751:TKS), 0 | Tokyotokeiba Co., Ltd. (9672:TKS), 0 | Sega Sammy Holdings Inc. (6460:TKS), 0 | KONAMI Group Corporation (9766:TKS), 0 | Flutter Entertainment Plc (FLTR:LON), 7,789 | DraftKings, Inc. Class A (DKNG:NAS), 0 | Aristocrat Leisure Limited (ALL:ASX), 0 | Netmarble Corp. (251270:KRX), 0 | Com2uS Holdings Corporation (063080:KRX), 0 | Entain PLC (ENT:LON), 563 | Manchester United Plc Class A (MANU:NYS), 0 | Celtic Plc (CCP:LON), 188 | Juventus Football Club (JUVE:BIT), 0

  • Astris Advisory
    • 11 pages


 

• Sports segment to lead the way – Q1–3 FY3/26 results reflected acquisitive sales growth following the consolidation of PointsBet Holdings, highlighting MIXI’s strategic shift toward the Sports segment. While the Betting business remains in an investment and scaling phase, strong user momentum was evident, with MAUs up 80% YoY, indicating growing traction for the TIPSTAR platform. Earnings decline in the mature Digital Entertainment segment is being managed with cost optimization, and the Lifestyle segment has improved profitability YoY. Overall, the current trajectory supports the Sports segment's potential to deliver a material long-term earnings contribution.

Sign up for free to access

Get access to the latest equity research in real-time from 12 commissioned providers.

Get access to the latest equity research in real-time from 12 commissioned providers.


Get Started
Already a member? Log in here

MIXI Inc. (2121) Q3 FY3/26 results update: Growth engine emerging


MIXI Inc. (2121:TKS), 0 | Gungho Online Entertainment, Inc. (3765:TKS), 0 | COLOPL, Inc. (3668:TKS), 0 | DeNA Co., Ltd. (2432:TKS), 0 | CyberAgent Incorporated (4751:TKS), 0 | Tokyotokeiba Co., Ltd. (9672:TKS), 0 | Sega Sammy Holdings Inc. (6460:TKS), 0 | KONAMI Group Corporation (9766:TKS), 0 | Flutter Entertainment Plc (FLTR:LON), 7,789 | DraftKings, Inc. Class A (DKNG:NAS), 0 | Aristocrat Leisure Limited (ALL:ASX), 0 | Netmarble Corp. (251270:KRX), 0 | Com2uS Holdings Corporation (063080:KRX), 0 | Entain PLC (ENT:LON), 563 | Manchester United Plc Class A (MANU:NYS), 0 | Celtic Plc (CCP:LON), 188 | Juventus Football Club (JUVE:BIT), 0

  • Published: 05 Feb 2026
  • Author:
  • Pages: 11
  • Astris Advisory


• Sports segment to lead the way – Q1–3 FY3/26 results reflected acquisitive sales growth following the consolidation of PointsBet Holdings, highlighting MIXI’s strategic shift toward the Sports segment. While the Betting business remains in an investment and scaling phase, strong user momentum was evident, with MAUs up 80% YoY, indicating growing traction for the TIPSTAR platform. Earnings decline in the mature Digital Entertainment segment is being managed with cost optimization, and the Lifestyle segment has improved profitability YoY. Overall, the current trajectory supports the Sports segment's potential to deliver a material long-term earnings contribution.

More Content

More Content

Ceres Inc. (3696) Initiating coverage Proven Business Incubator in Transition

Companies: CDLX 4751 CNCK 6562 3696 2491 4933 COIN GEMI 4819 ENVA HIMS ELF

Astris Advisory

Ladbrokes Coral and GVC reach takeover agreement

Companies: Ladbrokes Coral GroupEntain PLC

Research Tree

Social Network Game Development 23 March 2026

Companies: UBI TTWO GLUU NCTY EA RENN 4751 063080 181710 UBI TTWO PLTK 2432 3632 EA NCTY

Acquisdata

Most popular equity research this week | 22 Oct - 2 Nov

Companies: HMIARS9WNBWLVFATYM21WRBMTFAVONCSRTCGSTIDEELMFPOHEADHILSHTGAMSMACFMKLWOXIGAPPSCPARSWSUSTRIVIDZTFDISWMHAMERFPMEMRGRIHDYCKTSXXRKHJHDTRAKSOLGPHDVNETJET2LAMPINECALLHURCAMLAREPCAKGHTWDPIERHAYDCAKENAH7DIGRORGTLYW7LJOGCRDLKEYSGYGIBPORBWABBYFLTRENTGENLFSTSAAGF9QZDTXMFGEEC73S59QIO7RNOPF

Research Tree

Macbee Planet (7095) Q3 FY4/26 results update: Approaching an inflection point

Companies: QUOT CRTO QNST STGW CDLX ZUO 4751 9553 6562 4293 2491 2461 7095 FLNT 4180 4165 MGNI MCHX 2489

Astris Advisory
Research Tree
Useful Links
  • Features
  • Pricing
  • RNS/Newswires Feeds
  • Providers Hub
  • Company Hub
  • Stock Pick League
  • iOS and Android Apps
Account
  • Login
  • Join Now
  • Contact
  • Follow us on Linkedin
  • Follow us on X

© Research Tree 2026

  • Apple Store
  • Play Store
  • Terms of Service
  • Privacy Policy and Statement on Cookies

Research Tree will never share your details with third parties for marketing purposes. Research Tree distributes research documents that have been produced and approved by Financial Conduct Authority (FCA) Authorised & Regulated firms as well as relevant content from non-authorised sources, who are not regulated but the information is in the public domain. For the avoidance of doubt Research Tree is not giving advice, nor has Research Tree validated any of the information.

Research Tree is an Appointed Representative of Sturgeon Ventures which is Authorised and Regulated by the Financial Conduct Authority.

Top
  • Home
  • Features
  • Pricing
  • Event Hub
  • Reg.News
  • Short Interest Tracker
  • Explore Content
    • Regions
      • UK
      • Rest of EMEA
      • N America
      • APAC
      • LatAm
    • Exchanges
      • Aquis Apex
      • Australian Securities Exchange
      • Canadian Securities Exchange
      • Euronext Paris
      • London Stock Exchange (domestic)
      • SIX Swiss Exchange
    • Sectors
      • Automobile Industry
      • Banks
      • Building & Construction
      • Chemicals
      • Discretionary Personal Goods
      • Discretionary Retail
      • Energy
      • ETFs
      • Financial Services
      • Food & Drink
      • Food Production
      • Health
      • Household Goods & DIY
      • Industrial Equipment, Goods & Services
      • Insurance & Reinsurance
      • Investment Trusts
      • Leisure, Tourism & Travel
      • Media
      • Open-ended Funds
      • Other
      • Real Estate
      • Resources
      • Staple Retail
      • Technology
      • Telecoms
      • Trusts, ETFs & Funds
      • Utilities
    • Small / Large Cap
      • UK100
      • UK250
      • UK Smallcap
      • UK Other Main Markets
      • Other
    • Private/EIS
      • EIS Single Company
      • EIS/SEIS Funds
      • IHT Products
      • SEIS Single Company
      • VCT Funds
  • Providers
    • Free/Commissioned
      • Actinver
      • Actio Advisors
      • Allenby Capital
      • Alternative Resource Capital
      • Asset TV
      • Astris Advisory
      • Atrium Research
      • Baden Hill
      • BlytheRay
      • BNP Paribas Exane - Sponsored Research
      • Bondcritic
      • Bowsprit Partners Limited
      • Brand Communications
      • Brokerlink
      • BRR Media
      • Calvine Partners
      • Capital Access Group
      • Capital Link
      • Capital Markets Brokers
      • Cavendish
      • Checkpoint Partners
      • Clear Capital Markets
      • Couloir Capital
      • Doceo
      • Edison
      • EM Spreads
      • Engage Investor
      • Equity Development
      • eResearch
      • First Equity
      • Five Minute Pitch TV
      • focusIR
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • goetzpartners securities Limited
      • Golden Section Capital
      • GreenSome Finance
      • GSBR Research
      • H2 Radnor
      • Hardman & Co
      • Holland Advisors
      • Hypothesis Research
      • InterAxS Global
      • Kepler | Trust Intelligence
      • London Stock Exchange
      • Longspur Clean Energy
      • Mello Events
      • Messari Research
      • Morphose Capital Partners
      • MUFG Corporate Markets IR
      • Nippon Investment Bespoke Research UK
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Optimo Capital
      • Panmure Liberum
      • Paul Scott
      • Peel Hunt
      • PIWORLD / Progressive
      • Proactive
      • Progressive Equity Research
      • Quantum Research Group
      • QuotedData
      • RaaS Research Group
      • Research Dynamics
      • Research Tree
      • Resolve Research
      • SEAL Advisors Ltd
      • ShareSoc
      • Shore Capital
      • Sidoti & Company
      • Small Cap Consumer Research LLC
      • StockBox
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Curious Compounder
      • The Edge Group
      • The Investor Summit
      • The Life Sciences Division
      • ThinkFront
      • Ticker TV
      • Tring Triangle
      • Trinity Delta
      • Turner Pope Investments
      • UK Investor Group
      • ValueTrack
      • Venn Brown
      • Vox Markets
      • VRS International S.A. - Valuation & Research Specialists (VRS)
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Yaru Investments
      • Yellowstone Advisory
      • Zacks Small Cap Research
      • Zeus Capital
    • High Net Worth Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Acquisdata
      • AlphaValue
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • Baptista Research
      • BNP Paribas Exane - Sponsored Research
      • Canaccord Genuity
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • First Berlin
      • First Equity
      • First Sentinel
      • Greenwood Capital Partners
      • Hannam & Partners
      • Hybridan
      • Kemeny Capital
      • Longspur Clean Energy
      • Louis Capital
      • Magnitogorsk Iron and steel works
      • Medley Global Advisors
      • Northland Capital Partners
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • QuotedData Professional
      • Shard Capital
      • ShareSoc
      • Shore Capital
      • Singer Capital Markets
      • SP Angel
      • Stanford Capital Partners
      • Stifel FirstEnergy
      • Stockdale Securities
      • Tamesis Partners
      • Tennyson Securities
      • The Life Sciences Division
      • Turner Pope Investments
      • VSA Capital
      • Whitman Howard
      • xxxxxx_deleted
      • Yellowstone Advisory
      • Zeus Capital
    • Institutional Offering
      • Fox Davies Capital
      • ABG Sundal Collier
      • ACF Equity Research
      • Alternative Resource Capital
      • Arctic Securities
      • Arden Partners
      • Auctus Advisors
      • BNP Paribas Exane
      • Bondcritic
      • Canaccord Genuity
      • Capital Access Group
      • Capital Link
      • Cavendish
      • Couloir Capital
      • Degroof Petercam
      • Dowgate Capital
      • Edison
      • First Berlin
      • First Equity
      • First Sentinel
      • Five Minute Pitch TV
      • Fundamental Research Corp
      • Galliano’s Latin Notes
      • GBC AG
      • Golden Section Capital
      • Goodbody
      • Greenwood Capital Partners
      • Hannam & Partners
      • Holland Advisors
      • Hybridan
      • InterAxS Global
      • Investec Bank
      • Kepler | Trust Intelligence
      • Longspur Clean Energy
      • Numis
      • NuWays
      • OAK Securities
      • Oberon Capital
      • Panmure Liberum
      • Peel Hunt
      • QuotedData
      • QuotedData Professional
      • Research Dynamics
      • Research Tree
      • Shard Capital
      • Shore Capital
      • Sidoti & Company
      • Singer Capital Markets
      • Small Cap Consumer Research LLC
      • SP Angel
      • Stanford Capital Partners
      • Stifel
      • StockBox
      • Tamesis Partners
      • Tennyson Securities
      • The AIC
      • The Business Magazine Group
      • The Life Sciences Division
      • Tring Triangle
      • ValueTrack
      • Velocity Trade
      • VSA Capital
      • Winterflood Securities
      • World Platinum Investment Council
      • Zacks Small Cap Research
      • Zeus Capital
  • Contact
  • Sign Up
  • Sign In